(data stored in ACNUC7421 zone)

EMBL: CP001622.PE24

CP001622.PE24        Location/Qualifiers
FT   CDS             22950..24371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0024"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; SMART: regulatory protein GntR HTH; KEGG:
FT                   eca:ECA2654 GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54336"
FT                   /db_xref="GOA:C6AYB2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYB2"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ACS54336.1"
FT                   /translation="MTVAKSNDFPPLDPNAGVPFYRQIYDRFRAAIASGLLKPGDRIPS
FT                   ARALTKELGLARGTIESAYSLLAAEGYIESHGQAGTVVTPGLSTLTPVPVPALQQISNA
FT                   AEVSFRPDSILPFQMGLPALDAFPRKIWARLGAGCVRAMQPSDMVHPPIYGLPALRTEI
FT                   ATYLQVSRGIGCSPSQVFITSGYRHTIELIADTLLKAGDHVWLEDPGYPPTREIFRHMQ
FT                   ITTVPVRVDQDGMVISDGLKAAHGAVAAVVTPAHQSPLGMSLILPRRLALLDWAAKSKS
FT                   WIIEDDYDGEYRYVSRPLPALKSLDRNGRVLYSGTFSKVLFPGLRLAYLVVPEDLVERF
FT                   EHISQTLAGGSPELTQAIVTAFIKEGHFARHIQRMRKLYAQRRKATAIGLETVLGKHMS
FT                   IASQPGGMHLILQLKNQHSDRLLSARMRESGLYAEALADWTMLSEAPAALLVNFTNIGS
FT                   QSVAEHLAKRILQLM"
     MTVAKSNDFP PLDPNAGVPF YRQIYDRFRA AIASGLLKPG DRIPSARALT KELGLARGTI        60
     ESAYSLLAAE GYIESHGQAG TVVTPGLSTL TPVPVPALQQ ISNAAEVSFR PDSILPFQMG       120
     LPALDAFPRK IWARLGAGCV RAMQPSDMVH PPIYGLPALR TEIATYLQVS RGIGCSPSQV       180
     FITSGYRHTI ELIADTLLKA GDHVWLEDPG YPPTREIFRH MQITTVPVRV DQDGMVISDG       240
     LKAAHGAVAA VVTPAHQSPL GMSLILPRRL ALLDWAAKSK SWIIEDDYDG EYRYVSRPLP       300
     ALKSLDRNGR VLYSGTFSKV LFPGLRLAYL VVPEDLVERF EHISQTLAGG SPELTQAIVT       360
     AFIKEGHFAR HIQRMRKLYA QRRKATAIGL ETVLGKHMSI ASQPGGMHLI LQLKNQHSDR       420
     LLSARMRESG LYAEALADWT MLSEAPAALL VNFTNIGSQS VAEHLAKRIL QLM              473
//

If you have problems or comments...

PBIL Back to PBIL home page