(data stored in ACNUC7421 zone)

EMBL: CP001622.PE240

CP001622.PE240       Location/Qualifiers
FT   CDS             251851..253647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0241"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   rec:RHECIAT_CH0000630 acyl-CoA dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54552"
FT                   /db_xref="GOA:C6B0D3"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0D3"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACS54552.1"
FT                   /translation="MPVYKAPVNDTLFVLNDVLGLERYNNLPGFADATPDMIEAILGEA
FT                   GRVAEEALFPLNYSGDQEGCTRHDDASVSTPKGFKEAYKAYREGGWIGLAVPEEFGGQG
FT                   LPYTLHTAVGEYTSAANMSLMMYPGLTQGAIAALLVHGSDEQKATYLPKMVDGTWSGTM
FT                   NLTEPHCGTDLGMLRTKAVPQADGSYKISGQKIFISAGEHDLTGNIIHLVLARIEGAPE
FT                   GTKGISLFIVPKFLVGKDGAPGARNAVSCGAIEHKMGIHANATCVMNYDEATGFLIGAE
FT                   NRGLNAMFVMMNEARLMVGLQGIAISEIAYQNAASYARDRIQGRSLSGPKAPDKKADPI
FT                   IVHPDIRRTLMTIRAFNEAGRAFLLWTALKSDIAHRASDEKERQTADDILGLVTPILKG
FT                   VMTDKGFDHAVMAQQVFGGHGYIEEHGMSQYVRDARIAMIYEGANGIQALDLVGRKLAL
FT                   NGGRAAMALFKEIGDFCEENRGNEKLSFFTKHLKKGLNDAQGATMWFMQNAMAKPDNAG
FT                   AGSTDYMHLFGLVILGYMWAKMAKAAEDGLASGDAAREEYLKNKLVTARFFMERLMPET
FT                   ALRKARIEAGADTMMELAAEAF"
     MPVYKAPVND TLFVLNDVLG LERYNNLPGF ADATPDMIEA ILGEAGRVAE EALFPLNYSG        60
     DQEGCTRHDD ASVSTPKGFK EAYKAYREGG WIGLAVPEEF GGQGLPYTLH TAVGEYTSAA       120
     NMSLMMYPGL TQGAIAALLV HGSDEQKATY LPKMVDGTWS GTMNLTEPHC GTDLGMLRTK       180
     AVPQADGSYK ISGQKIFISA GEHDLTGNII HLVLARIEGA PEGTKGISLF IVPKFLVGKD       240
     GAPGARNAVS CGAIEHKMGI HANATCVMNY DEATGFLIGA ENRGLNAMFV MMNEARLMVG       300
     LQGIAISEIA YQNAASYARD RIQGRSLSGP KAPDKKADPI IVHPDIRRTL MTIRAFNEAG       360
     RAFLLWTALK SDIAHRASDE KERQTADDIL GLVTPILKGV MTDKGFDHAV MAQQVFGGHG       420
     YIEEHGMSQY VRDARIAMIY EGANGIQALD LVGRKLALNG GRAAMALFKE IGDFCEENRG       480
     NEKLSFFTKH LKKGLNDAQG ATMWFMQNAM AKPDNAGAGS TDYMHLFGLV ILGYMWAKMA       540
     KAAEDGLASG DAAREEYLKN KLVTARFFME RLMPETALRK ARIEAGADTM MELAAEAF         598
//

If you have problems or comments...

PBIL Back to PBIL home page