(data stored in ACNUC7421 zone)

EMBL: CP001622.PE241

CP001622.PE241       Location/Qualifiers
FT   CDS             253787..254995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0242"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: ret:RHE_CH00558 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54553"
FT                   /db_xref="GOA:C6B0D4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0D4"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ACS54553.1"
FT                   /translation="MTEVFIYDHVRTPRGRGKKDGALHEVPSVRLAAKTLEAIRDRNGL
FT                   DTATVDDIIMGCVDPVMDAGAVIPKAAAFEAGYSTKAPGMQISRFCASGLDAVNFGAGK
FT                   IAQGADDIVIAGGVESMSRVGLGMSGGAWFMDPSVNFPAYFMPQGVSADLIATKYGFSR
FT                   TDVDAYAVESQKRAAHAWEKGWFDKSVIPVKDQNGLTILAKDEHMRPGTDMQALASLNP
FT                   SFQMPGEMGGFEAVGIQAHPEIERINYVHHAGNSSGIVDGASVVLLGSKAGGQSMGKKP
FT                   RARIKAFANIGSDPALMLTGPVDVTEKLLKRSGMSLSDIDLFELNEAFAAVVLRYMQAF
FT                   DIDHDRINVNGGAIAMGHPLGATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATVI
FT                   ERV"
     MTEVFIYDHV RTPRGRGKKD GALHEVPSVR LAAKTLEAIR DRNGLDTATV DDIIMGCVDP        60
     VMDAGAVIPK AAAFEAGYST KAPGMQISRF CASGLDAVNF GAGKIAQGAD DIVIAGGVES       120
     MSRVGLGMSG GAWFMDPSVN FPAYFMPQGV SADLIATKYG FSRTDVDAYA VESQKRAAHA       180
     WEKGWFDKSV IPVKDQNGLT ILAKDEHMRP GTDMQALASL NPSFQMPGEM GGFEAVGIQA       240
     HPEIERINYV HHAGNSSGIV DGASVVLLGS KAGGQSMGKK PRARIKAFAN IGSDPALMLT       300
     GPVDVTEKLL KRSGMSLSDI DLFELNEAFA AVVLRYMQAF DIDHDRINVN GGAIAMGHPL       360
     GATGAMILGT VLDELERRDL NTALVTLCIG AGMGTATVIE RV                          402
//

If you have problems or comments...

PBIL Back to PBIL home page