(data stored in ACNUC7421 zone)

EMBL: CP001622.PE242

CP001622.PE242       Location/Qualifiers
FT   CDS             254998..255381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0243"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   bac:BamMC406_6039 cupin 2 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54554"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0D5"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ACS54554.1"
FT                   /translation="MGFNTGTIETEYAEVSEHWSPRVIADLNGQSVKLAKVRGQLAWHS
FT                   HRDEDELFLIWKGALTIEYRDRPHVHLKSGDFHVVPRGVEHNPVAEEECWIVLFEPSLT
FT                   KHTGDVVTEKTKTLDAQRSHLPA"
     MGFNTGTIET EYAEVSEHWS PRVIADLNGQ SVKLAKVRGQ LAWHSHRDED ELFLIWKGAL        60
     TIEYRDRPHV HLKSGDFHVV PRGVEHNPVA EEECWIVLFE PSLTKHTGDV VTEKTKTLDA       120
     QRSHLPA                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page