(data stored in ACNUC7421 zone)

EMBL: CP001622.PE243

CP001622.PE243       Location/Qualifiers
FT   CDS             255398..257611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0244"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   Enoyl-CoA hydratase/isomerase; 3-hydroxyacyl-CoA
FT                   dehydrogenase domain protein; KEGG: ret:RHE_CH00559
FT                   enoyl-CoA hydratase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54555"
FT                   /db_xref="GOA:C6B0D6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0D6"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /protein_id="ACS54555.1"
FT                   /translation="MTYTNFTLETDADGIALVTWDMPGKSMNVFTAEVMAELDAIIDAT
FT                   TADAAVKGVVFTSGKSSFSGGADLSMIKSMFSSYQEEKAKSPETAVQNLFGLVGRMSGL
FT                   FRKLEISGKPWVSAINGTCMGGAFELSLACHGRVASNAKSVKIALPEVKVGIFPGAGGT
FT                   QRVPRLANAQDALQMMTTGQSLTGSRAKAMNLVHQVVEPDQLIPAAKQMIKDGLKPVAP
FT                   WDEKGFKAPGGGIWTPASAQLWPAAPAILRRETSGNYPAALAILKCVYEGLQVPFDTGL
FT                   KIEQRYFTEVLQTREAFSMIRSLFISMQELGKGARRPAGHAKTELKHVGVVGAGFMGAS
FT                   IAYVTAAAGIPVTLIDRDIEAATKGKTVSEGLVKDSIGKGRLTQDEAAALLSRITPSAD
FT                   YADLANADLVIEAVFEDREVKKAVIEAVEAVLPEGAIFASNTSTLPISGLAKNSKRPAD
FT                   FIGIHFFSPVEKMMLTEVILGSDTGDKALAVALDYVAAIRKTPIVVNDTRGFFVNRCVL
FT                   RYMSESYDMLIEGVPPVMIENAAKMAGMPVGPLALNDEVAIDLSLKILKATVADLGEKA
FT                   IDPRHMDLISSMVEKEGRFGRKNSKGFYDYPPKPAKKSLWPDLKSFYPQKQADEVDVNV
FT                   LKQRFLVTIALEAARTVEEGIVTDPREADVGSILGFGFAPYTGGALSYIDGMGAKAFVE
FT                   LAEKLAGTYGKHFKPTPLLKDMAAKGETFYGRFDPYAKVGKAA"
     MTYTNFTLET DADGIALVTW DMPGKSMNVF TAEVMAELDA IIDATTADAA VKGVVFTSGK        60
     SSFSGGADLS MIKSMFSSYQ EEKAKSPETA VQNLFGLVGR MSGLFRKLEI SGKPWVSAIN       120
     GTCMGGAFEL SLACHGRVAS NAKSVKIALP EVKVGIFPGA GGTQRVPRLA NAQDALQMMT       180
     TGQSLTGSRA KAMNLVHQVV EPDQLIPAAK QMIKDGLKPV APWDEKGFKA PGGGIWTPAS       240
     AQLWPAAPAI LRRETSGNYP AALAILKCVY EGLQVPFDTG LKIEQRYFTE VLQTREAFSM       300
     IRSLFISMQE LGKGARRPAG HAKTELKHVG VVGAGFMGAS IAYVTAAAGI PVTLIDRDIE       360
     AATKGKTVSE GLVKDSIGKG RLTQDEAAAL LSRITPSADY ADLANADLVI EAVFEDREVK       420
     KAVIEAVEAV LPEGAIFASN TSTLPISGLA KNSKRPADFI GIHFFSPVEK MMLTEVILGS       480
     DTGDKALAVA LDYVAAIRKT PIVVNDTRGF FVNRCVLRYM SESYDMLIEG VPPVMIENAA       540
     KMAGMPVGPL ALNDEVAIDL SLKILKATVA DLGEKAIDPR HMDLISSMVE KEGRFGRKNS       600
     KGFYDYPPKP AKKSLWPDLK SFYPQKQADE VDVNVLKQRF LVTIALEAAR TVEEGIVTDP       660
     READVGSILG FGFAPYTGGA LSYIDGMGAK AFVELAEKLA GTYGKHFKPT PLLKDMAAKG       720
     ETFYGRFDPY AKVGKAA                                                      737
//

If you have problems or comments...

PBIL Back to PBIL home page