(data stored in ACNUC7421 zone)

EMBL: CP001622.PE244

CP001622.PE244       Location/Qualifiers
FT   CDS             257728..258291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0245"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_3660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54556"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0D7"
FT                   /inference="similar to AA sequence:KEGG:MXAN_3660"
FT                   /protein_id="ACS54556.1"
FT                   /translation="MQPSTDILAFADPMEWESWLCLHHAASTGAWLKIGKKNPKRTLIT
FT                   IDEALDVALCYGWIDSQRKGFDAHSYLQRYSPRRAKSSWSKLNVDRVAALAETGRMRPA
FT                   GLAEVAAAKADGRWAVAYAPQRDAGLPDDLAAALAENAAADAAFARLDKTGQYAIVLPL
FT                   LKATTPEVRVARLGKAITRLAQAE"
     MQPSTDILAF ADPMEWESWL CLHHAASTGA WLKIGKKNPK RTLITIDEAL DVALCYGWID        60
     SQRKGFDAHS YLQRYSPRRA KSSWSKLNVD RVAALAETGR MRPAGLAEVA AAKADGRWAV       120
     AYAPQRDAGL PDDLAAALAE NAAADAAFAR LDKTGQYAIV LPLLKATTPE VRVARLGKAI       180
     TRLAQAE                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page