(data stored in ACNUC7421 zone)

EMBL: CP001622.PE246

CP001622.PE246       Location/Qualifiers
FT   CDS             complement(258973..259407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0247"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: rec:RHECIAT_CH0000634 probable
FT                   transcriptional regulator protein, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54558"
FT                   /db_xref="GOA:C6B0D9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0D9"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACS54558.1"
FT                   /translation="MEGDAFSAFAITALRLAGHLTAAGDQLAKPAGQTSARWQVLAAAR
FT                   RGGMSVAQIARALGVARQGVQRLADVLENEGLIAYADNPQHQRAKLVRLTEEGAARLGV
FT                   IEIAQAGWADGLGAAFTSAELDAARVVMARVMEMLEGGEA"
     MEGDAFSAFA ITALRLAGHL TAAGDQLAKP AGQTSARWQV LAAARRGGMS VAQIARALGV        60
     ARQGVQRLAD VLENEGLIAY ADNPQHQRAK LVRLTEEGAA RLGVIEIAQA GWADGLGAAF       120
     TSAELDAARV VMARVMEMLE GGEA                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page