(data stored in ACNUC7421 zone)

EMBL: CP001622.PE247

CP001622.PE247       Location/Qualifiers
FT   CDS             259523..259927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0248"
FT                   /product="glutathione-dependent formaldehyde-activating
FT                   GFA"
FT                   /note="PFAM: glutathione-dependent formaldehyde-activating
FT                   GFA; KEGG: ret:RHE_CH00562 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54559"
FT                   /db_xref="GOA:C6B0E0"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0E0"
FT                   /inference="protein motif:PFAM:PF04828"
FT                   /protein_id="ACS54559.1"
FT                   /translation="MKKTYRGSCHCGKVHYQVDMDLEEGTGRCNCSICAKRRYWGANVK
FT                   PEDFRLMCDQAETSDYQFNTMSGHHRFCRTCGVPAYGDGYVEQIGGAYVSINIACLDDI
FT                   TPEELAALPVRYADGRHDAWWNEPAVTSYL"
     MKKTYRGSCH CGKVHYQVDM DLEEGTGRCN CSICAKRRYW GANVKPEDFR LMCDQAETSD        60
     YQFNTMSGHH RFCRTCGVPA YGDGYVEQIG GAYVSINIAC LDDITPEELA ALPVRYADGR       120
     HDAWWNEPAV TSYL                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page