(data stored in ACNUC7421 zone)

EMBL: CP001622.PE248

CP001622.PE248       Location/Qualifiers
FT   CDS             260021..260464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000636 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54560"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0E1"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000636"
FT                   /protein_id="ACS54560.1"
FT                   /translation="MKDEANARIEEEAIIAMLMMRAKALGEKNASDALSYEAEDSVEFS
FT                   LAPPLVYHGQDEAGLQAWFDTWEGPIGGEVRDARLTVGEDVAFWSGLTRMSGTKTDGTA
FT                   VDLWFRQTLGLVKQDGRWLVAHQHASVPFAMDGSGRALLDLKP"
     MKDEANARIE EEAIIAMLMM RAKALGEKNA SDALSYEAED SVEFSLAPPL VYHGQDEAGL        60
     QAWFDTWEGP IGGEVRDARL TVGEDVAFWS GLTRMSGTKT DGTAVDLWFR QTLGLVKQDG       120
     RWLVAHQHAS VPFAMDGSGR ALLDLKP                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page