(data stored in ACNUC7421 zone)

EMBL: CP001622.PE249

CP001622.PE249       Location/Qualifiers
FT   CDS             complement(260474..261676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0250"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rec:RHECIAT_CH0000637 probable transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54561"
FT                   /db_xref="GOA:C6B0E2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0E2"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS54561.1"
FT                   /translation="MFAAAKSTENSPRPSIGFHALTLATFFGASAAPTPLYRIYQESFS
FT                   VSPVLITVIFAVYAFALLAALLIAGSISDHLGRKPVIFFALVLEIAAMGLFVVASGPAW
FT                   LIAARIVQGLATGIAGASIGAALVDVDRAKGQIVNSIAPLCGMAVGAVGTSALIQYGPF
FT                   PMHLVYALLLVAFTLQAAAIWLTGETGGTRPGALGSLIPRVTIPQQVKRPLSLVTPINI
FT                   ANWTLAGFYLSLVPSLVASTTGSRAPLTGGAVVTALMVSGAIAVYLRRSKTASANLVFG
FT                   VSAKTLGILTVVAGVHLANVPLLLVGTIFTGVGFGTNFLGSIGTIMPLAKPDERAGLLS
FT                   AFYVQSYLAFSLPAILAGFLAKSAGYALTTDIYATAILLLMGVGMVSIRADRRRVAESA
FT                   A"
     MFAAAKSTEN SPRPSIGFHA LTLATFFGAS AAPTPLYRIY QESFSVSPVL ITVIFAVYAF        60
     ALLAALLIAG SISDHLGRKP VIFFALVLEI AAMGLFVVAS GPAWLIAARI VQGLATGIAG       120
     ASIGAALVDV DRAKGQIVNS IAPLCGMAVG AVGTSALIQY GPFPMHLVYA LLLVAFTLQA       180
     AAIWLTGETG GTRPGALGSL IPRVTIPQQV KRPLSLVTPI NIANWTLAGF YLSLVPSLVA       240
     STTGSRAPLT GGAVVTALMV SGAIAVYLRR SKTASANLVF GVSAKTLGIL TVVAGVHLAN       300
     VPLLLVGTIF TGVGFGTNFL GSIGTIMPLA KPDERAGLLS AFYVQSYLAF SLPAILAGFL       360
     AKSAGYALTT DIYATAILLL MGVGMVSIRA DRRRVAESAA                             400
//

If you have problems or comments...

PBIL Back to PBIL home page