(data stored in ACNUC7421 zone)

EMBL: CP001622.PE25

CP001622.PE25        Location/Qualifiers
FT   CDS             24569..25030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0025"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   bph:Bphy_6989 alkylhydroperoxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54337"
FT                   /db_xref="GOA:C6AYB3"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYB3"
FT                   /inference="protein motif:TFAM:TIGR00778"
FT                   /protein_id="ACS54337.1"
FT                   /translation="MDFFMADRIDCASASPDGFNAFAGVRAAVEKSDLPKQLFDLVYLR
FT                   VSQMNRSALYVDVHSRSLLELGLTVEKLGQVPIWRNAGHLFNARERSALAWAETVTRVA
FT                   ETGVPDSDYEAAAVEFNNKELADLTYAIALMNALNRIGMAFRSTLSGKA"
     MDFFMADRID CASASPDGFN AFAGVRAAVE KSDLPKQLFD LVYLRVSQMN RSALYVDVHS        60
     RSLLELGLTV EKLGQVPIWR NAGHLFNARE RSALAWAETV TRVAETGVPD SDYEAAAVEF       120
     NNKELADLTY AIALMNALNR IGMAFRSTLS GKA                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page