(data stored in ACNUC7421 zone)

EMBL: CP001622.PE250

CP001622.PE250       Location/Qualifiers
FT   CDS             261814..262371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0251"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   rec:RHECIAT_CH0000638 probable transcriptional regulator
FT                   protein, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54562"
FT                   /db_xref="GOA:C6B0E3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0E3"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS54562.1"
FT                   /translation="MTVKENLRPGGRSARVQASVHKAVRELMAEMSRAEVTIPLIAGKA
FT                   GVTPSTIYRRWGDLQELLADVAVDRLRPDMQPIDAGSGKADLETWAEQYAEEMSSGPGR
FT                   EMIRDVLAAQAGANACKCAEFTRQQVDVIAERAKARGEAFPDVDRVMDQVVAPIMYRIL
FT                   FGDVPATARVRDLVARVMSATD"
     MTVKENLRPG GRSARVQASV HKAVRELMAE MSRAEVTIPL IAGKAGVTPS TIYRRWGDLQ        60
     ELLADVAVDR LRPDMQPIDA GSGKADLETW AEQYAEEMSS GPGREMIRDV LAAQAGANAC       120
     KCAEFTRQQV DVIAERAKAR GEAFPDVDRV MDQVVAPIMY RILFGDVPAT ARVRDLVARV       180
     MSATD                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page