(data stored in ACNUC7421 zone)

EMBL: CP001622.PE251

CP001622.PE251       Location/Qualifiers
FT   CDS             complement(262483..266007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0252"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; PAS fold-4 domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; response regulator receiver;
FT                   histidine kinase A domain protein; KEGG: ret:RHE_CH00566
FT                   two-component sensor histidine kinase/response regulator
FT                   hybrid protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54563"
FT                   /db_xref="GOA:C6B0E4"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0E4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACS54563.1"
FT                   /translation="MLPGWVIFASAFGYLLLLFAVASYGDRKNRSPGTLDRGRGTLEGG
FT                   WPVVYALSLAIYCTSWTYFGSVGLAAQRGLEFAGIYIGPILVFTLGMPLLRRIIELAKA
FT                   EKLTSVADFVAARYGKNPTVATIVALISLIGAIPYIALQLKAISSTVSAMVNPSDYGIG
FT                   SGNLYFLDLPLVATLVLACFAIMFGTRHTDATEHQDGLILAVSMESVVKLVAFLTAGVC
FT                   VIWFLFDGPTDLWRRTVDNELVMSALNYHTPISRWITLIILSAFAIILLPRQFHVTVVE
FT                   NRTPKQLKLAGILFPSYLIAINLFVLPVAIGGLLTFGGSGNADFYMLSLPLAGQMPVIS
FT                   LIIFIGGFSAATAMVIVDSVALSIMVSNDIIMPIFLRRKLAGRASLRDNFAKTLLNIRR
FT                   SAIFAVLLFGYAYYRSTDSTAGLASIGLLSFAAIAQIAPALFGGLIWRRANARGAILGL
FT                   SSGFIIWIYLLFLPSLGGPDYSYVASAVLGFIFPGTTLFTAPDADPLVNATAMSLLVNT
FT                   AFFVVGSLTRNAKPLERIQAGIFVKRHSRSQFATRGWKTRISVGDLKAAISRYLGEERM
FT                   QRSLTTYEQSSGRKLEDEQPADMALIHFSEQLLGSAIGSSSARLVLSLILQKIEDASSD
FT                   TAWLLDQASEALQYNQDMLQTALSQMDQGIAVFDSSNRLTIWNRRFRQLLDLPESAGQV
FT                   GFPLSDIVTTLIQRGDIAPGDLSQTVRHFLTLDKPFSLVLGGGERIIEVRSNAMPDKGI
FT                   VATFTDITQRVSADQALKQANETLEQRVAERTAELTRVNRELGEARAAADEANIGKTRF
FT                   FAAAGHDILQPLNAARLYSSALVERMAQSENSLIVRNIDSALESVETILGAVLDISRLD
FT                   TGAMRPRLASVALSDLLERIQTDFAPIAREKQLKLVIMPTSLRVRSDPNLLRRLVQNLV
FT                   SNAIKYTISGKVLVGARRRGNQVIIQVIDSGIGIPPSKFRTVFKEFARLDEGAKTASGL
FT                   GLGLSIVDRIARVLNHPVELQSTHGKGTEFRIAMPLDVSRPAAATAAITPADRPGQPLS
FT                   GLKILCIDNEPKILEGMRLLISGWGCEVEALDCLADVIALDGQEGPPDIVIADYHLGDG
FT                   TGIAAILHLRRQFGADIPALLITADRTPEVRSEAERDGIAVQHKPVRPAALRAYITQIS
FT                   GLKRAAAE"
     MLPGWVIFAS AFGYLLLLFA VASYGDRKNR SPGTLDRGRG TLEGGWPVVY ALSLAIYCTS        60
     WTYFGSVGLA AQRGLEFAGI YIGPILVFTL GMPLLRRIIE LAKAEKLTSV ADFVAARYGK       120
     NPTVATIVAL ISLIGAIPYI ALQLKAISST VSAMVNPSDY GIGSGNLYFL DLPLVATLVL       180
     ACFAIMFGTR HTDATEHQDG LILAVSMESV VKLVAFLTAG VCVIWFLFDG PTDLWRRTVD       240
     NELVMSALNY HTPISRWITL IILSAFAIIL LPRQFHVTVV ENRTPKQLKL AGILFPSYLI       300
     AINLFVLPVA IGGLLTFGGS GNADFYMLSL PLAGQMPVIS LIIFIGGFSA ATAMVIVDSV       360
     ALSIMVSNDI IMPIFLRRKL AGRASLRDNF AKTLLNIRRS AIFAVLLFGY AYYRSTDSTA       420
     GLASIGLLSF AAIAQIAPAL FGGLIWRRAN ARGAILGLSS GFIIWIYLLF LPSLGGPDYS       480
     YVASAVLGFI FPGTTLFTAP DADPLVNATA MSLLVNTAFF VVGSLTRNAK PLERIQAGIF       540
     VKRHSRSQFA TRGWKTRISV GDLKAAISRY LGEERMQRSL TTYEQSSGRK LEDEQPADMA       600
     LIHFSEQLLG SAIGSSSARL VLSLILQKIE DASSDTAWLL DQASEALQYN QDMLQTALSQ       660
     MDQGIAVFDS SNRLTIWNRR FRQLLDLPES AGQVGFPLSD IVTTLIQRGD IAPGDLSQTV       720
     RHFLTLDKPF SLVLGGGERI IEVRSNAMPD KGIVATFTDI TQRVSADQAL KQANETLEQR       780
     VAERTAELTR VNRELGEARA AADEANIGKT RFFAAAGHDI LQPLNAARLY SSALVERMAQ       840
     SENSLIVRNI DSALESVETI LGAVLDISRL DTGAMRPRLA SVALSDLLER IQTDFAPIAR       900
     EKQLKLVIMP TSLRVRSDPN LLRRLVQNLV SNAIKYTISG KVLVGARRRG NQVIIQVIDS       960
     GIGIPPSKFR TVFKEFARLD EGAKTASGLG LGLSIVDRIA RVLNHPVELQ STHGKGTEFR      1020
     IAMPLDVSRP AAATAAITPA DRPGQPLSGL KILCIDNEPK ILEGMRLLIS GWGCEVEALD      1080
     CLADVIALDG QEGPPDIVIA DYHLGDGTGI AAILHLRRQF GADIPALLIT ADRTPEVRSE      1140
     AERDGIAVQH KPVRPAALRA YITQISGLKR AAAE                                  1174
//

If you have problems or comments...

PBIL Back to PBIL home page