(data stored in ACNUC7421 zone)

EMBL: CP001622.PE252

CP001622.PE252       Location/Qualifiers
FT   CDS             266230..266667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0253"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="TIGRFAM: large conductance mechanosensitive channel
FT                   protein; PFAM: large-conductance mechanosensitive channel;
FT                   KEGG: rec:RHECIAT_CH0000640 large-conductance
FT                   mechanosensitive channel transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54564"
FT                   /db_xref="GOA:C6B0E5"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0E5"
FT                   /inference="protein motif:TFAM:TIGR00220"
FT                   /protein_id="ACS54564.1"
FT                   /translation="MLNEFKAFIARGNVMDLAVGVIIGGAFGGIVKSLVDDLIMPIVGA
FT                   IFGGFDFSNYFLPLSSAVNAQSLAAAREQGAVFAYGSFLTVLINFLILAWIIFLMVKGV
FT                   NTLRAQVERQEKVAPEELPAPPADVQLLTEIRDLLATRPTA"
     MLNEFKAFIA RGNVMDLAVG VIIGGAFGGI VKSLVDDLIM PIVGAIFGGF DFSNYFLPLS        60
     SAVNAQSLAA AREQGAVFAY GSFLTVLINF LILAWIIFLM VKGVNTLRAQ VERQEKVAPE       120
     ELPAPPADVQ LLTEIRDLLA TRPTA                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page