(data stored in ACNUC7421 zone)

EMBL: CP001622.PE253

CP001622.PE253       Location/Qualifiers
FT   CDS             266790..267956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0254"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   ret:RHE_CH00568 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54565"
FT                   /db_xref="GOA:C6B0E6"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0E6"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACS54565.1"
FT                   /translation="MSIVSSLSPRALAAPESGIVELVNYARGREGLLPLWVGEGDLPTP
FT                   DFISRAAMDALASGETFYTWQRGIPELRQALSDYYDRHFGIRLPVEHFYVTGSGMQAIQ
FT                   IAVQALTSPGDELVYLSPSWPNIAAALEIAGARSLSVELQFEGGKWAVDLDRIETAITP
FT                   KTKGIFINTPSNPTGWTATKQDLGDLLALARKHDLWIMADEIYARYYFAGGRAPSFLDV
FT                   MEPDDKIIFVNSFSKNWSMTGWRVGWIVAPPEMGQVLENLIQYSTSGVAQFMQKGAVAA
FT                   LDQGDDFVAANIAKAARSRDTLCDALVATNRVETLKPDGAIYAFLKIDGVADSRTAALD
FT                   IVDKTGVGLAPGTAFGSGGELFLRACFLRDPTQVAIAAERLCDYILKL"
     MSIVSSLSPR ALAAPESGIV ELVNYARGRE GLLPLWVGEG DLPTPDFISR AAMDALASGE        60
     TFYTWQRGIP ELRQALSDYY DRHFGIRLPV EHFYVTGSGM QAIQIAVQAL TSPGDELVYL       120
     SPSWPNIAAA LEIAGARSLS VELQFEGGKW AVDLDRIETA ITPKTKGIFI NTPSNPTGWT       180
     ATKQDLGDLL ALARKHDLWI MADEIYARYY FAGGRAPSFL DVMEPDDKII FVNSFSKNWS       240
     MTGWRVGWIV APPEMGQVLE NLIQYSTSGV AQFMQKGAVA ALDQGDDFVA ANIAKAARSR       300
     DTLCDALVAT NRVETLKPDG AIYAFLKIDG VADSRTAALD IVDKTGVGLA PGTAFGSGGE       360
     LFLRACFLRD PTQVAIAAER LCDYILKL                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page