(data stored in ACNUC7421 zone)

EMBL: CP001622.PE254

CP001622.PE254       Location/Qualifiers
FT   CDS             268177..269211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0255"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="TIGRFAM: UDP-glucose 4-epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; Male sterility domain;
FT                   polysaccharide biosynthesis protein CapD; short-chain
FT                   dehydrogenase/reductase SDR; dTDP-4-dehydrorhamnose
FT                   reductase; KEGG: ret:RHE_CH00569 UDP-glucose 4-epimerase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54566"
FT                   /db_xref="GOA:C6B0E7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0E7"
FT                   /inference="protein motif:TFAM:TIGR01179"
FT                   /protein_id="ACS54566.1"
FT                   /translation="MAVLVTGGAGYIGSHMVWALLDAGEDVVVLDRLSTGFRWAVAPAA
FT                   RFYLGDVADPDILKKVFIENDIEAIIHFAGSAVVPVSVADPLSYYDNNSGKTRALLSAS
FT                   VKAGIRNFVFSSTAAVYGQQKTDLPVKETAPLNPENPYGQSKLMTEFMLRDAAAAYDFN
FT                   YVALRYFNVAGADPHHRAGQSTSGATHLIKVACEAALGRRDSVNVYGVDYPTHDGTGVR
FT                   DYIHVSDLTDAHLKALQHLRRSKGSLVANCGYGSGYSVLDVLNMVTRLHGHSFKIHMAP
FT                   RRAGDSASVVADASLARQVLDWKPRYDSLETIVQSSLDWELFLSNKNVDDLHSIHRALA
FT                   AASF"
     MAVLVTGGAG YIGSHMVWAL LDAGEDVVVL DRLSTGFRWA VAPAARFYLG DVADPDILKK        60
     VFIENDIEAI IHFAGSAVVP VSVADPLSYY DNNSGKTRAL LSASVKAGIR NFVFSSTAAV       120
     YGQQKTDLPV KETAPLNPEN PYGQSKLMTE FMLRDAAAAY DFNYVALRYF NVAGADPHHR       180
     AGQSTSGATH LIKVACEAAL GRRDSVNVYG VDYPTHDGTG VRDYIHVSDL TDAHLKALQH       240
     LRRSKGSLVA NCGYGSGYSV LDVLNMVTRL HGHSFKIHMA PRRAGDSASV VADASLARQV       300
     LDWKPRYDSL ETIVQSSLDW ELFLSNKNVD DLHSIHRALA AASF                        344
//

If you have problems or comments...

PBIL Back to PBIL home page