(data stored in ACNUC7421 zone)

EMBL: CP001622.PE255

CP001622.PE255       Location/Qualifiers
FT   CDS             269319..271280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0256"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="KEGG: rec:RHECIAT_CH0000643 putative sensory
FT                   box/GGDEF family protein; TIGRFAM: diguanylate cyclase;
FT                   PFAM: EAL domain protein; GGDEF domain containing protein;
FT                   SMART: EAL domain protein; GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54567"
FT                   /db_xref="GOA:C6B0E8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0E8"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACS54567.1"
FT                   /translation="MKNFLASLQLQKDNPTLLLAQFRALSSQIPILYVLLVINALAVAI
FT                   THLKSAPLWLSLYIPVALSVVCVFRLCWWEIRGKENVTAERAYRLMKLTISGAGILAVA
FT                   FGSWAIALYQYGDASQQGQIAYFLVVTGISCIFCLMHLPMAAALTTVITFSAMVATFLF
FT                   SGNPVFVATAISGLFLILPFLRVINSYFQNFVGLVQLTEELKQKQAEAEELNLVNSRNA
FT                   LHDQLTGLANRRSFFLSLEKRLQKDSSTPPVLGILDLDGFKPVNDVFGHAAGDLVLKET
FT                   ARRFVALVGEEGIVSRLGGDEFGIIFPSLMTRQAIADLGQALCAAVRDPFEIPDGSVRV
FT                   FGSCGIVYPDIGTYTAEDLYEKADFALYQVKSKRSSGVEFFSAEHEKILTQRHLIELEL
FT                   QANDFAKELKLDYQPIVELRSGRVVAYEALARWDSARFGRISPDAFIPAAERTAVIGRI
FT                   TRILFAKALEALAIIPRHLRLSFNLSARDICDHETSMALLAMITRSGIDPKRIEFEITE
FT                   TALLSDFDTADQVISMLRAAGISIALDDFGTGYSSLSHIHRLGFDKLKIDKSFVMNFDR
FT                   DARCMNITRSVANLCQNLGIASVAEGVESEEIAEGLKAMGVRLAQGYHFSRPLPLELAI
FT                   DYAARCEAAASARNSLSA"
     MKNFLASLQL QKDNPTLLLA QFRALSSQIP ILYVLLVINA LAVAITHLKS APLWLSLYIP        60
     VALSVVCVFR LCWWEIRGKE NVTAERAYRL MKLTISGAGI LAVAFGSWAI ALYQYGDASQ       120
     QGQIAYFLVV TGISCIFCLM HLPMAAALTT VITFSAMVAT FLFSGNPVFV ATAISGLFLI       180
     LPFLRVINSY FQNFVGLVQL TEELKQKQAE AEELNLVNSR NALHDQLTGL ANRRSFFLSL       240
     EKRLQKDSST PPVLGILDLD GFKPVNDVFG HAAGDLVLKE TARRFVALVG EEGIVSRLGG       300
     DEFGIIFPSL MTRQAIADLG QALCAAVRDP FEIPDGSVRV FGSCGIVYPD IGTYTAEDLY       360
     EKADFALYQV KSKRSSGVEF FSAEHEKILT QRHLIELELQ ANDFAKELKL DYQPIVELRS       420
     GRVVAYEALA RWDSARFGRI SPDAFIPAAE RTAVIGRITR ILFAKALEAL AIIPRHLRLS       480
     FNLSARDICD HETSMALLAM ITRSGIDPKR IEFEITETAL LSDFDTADQV ISMLRAAGIS       540
     IALDDFGTGY SSLSHIHRLG FDKLKIDKSF VMNFDRDARC MNITRSVANL CQNLGIASVA       600
     EGVESEEIAE GLKAMGVRLA QGYHFSRPLP LELAIDYAAR CEAAASARNS LSA              653
//

If you have problems or comments...

PBIL Back to PBIL home page