(data stored in ACNUC7421 zone)

EMBL: CP001622.PE256

CP001622.PE256       Location/Qualifiers
FT   CDS             271364..272416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0257"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   rec:RHECIAT_CH0000644 probable enoyl-CoA hydratase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54568"
FT                   /db_xref="GOA:C6B0E9"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR032259"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0E9"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACS54568.1"
FT                   /translation="MQDGEVIIERRGTAGVIRLNRPRALNSLTLPMIRTITAALHDFAG
FT                   DPEVASVVATGEGERGFCAGGDIRALHESARAGDGLAASFWREEFRLNHMIASYPKPYV
FT                   ALMDGITMGGGVGLSSHGRHRIVTERTRLAMPETGIGYVPDVGATWLLPRGPGEAGTWL
FT                   GLTGLDIGAADAIHARLADLQIASSRLGEAIDALSALPRASSSGDVDAVLQALPEPQGE
FT                   SRLRQNAAMIDRAFCFDNVEEILATLAEEEGEFAAETRRVLLTRSPTSLKLALRLLRAG
FT                   RSSASLAECLGRELGACLRMLDNPDFFEGIRAAVIDKDRNPKWSPASVEAVEVARVEHF
FT                   LKPAEPPLSL"
     MQDGEVIIER RGTAGVIRLN RPRALNSLTL PMIRTITAAL HDFAGDPEVA SVVATGEGER        60
     GFCAGGDIRA LHESARAGDG LAASFWREEF RLNHMIASYP KPYVALMDGI TMGGGVGLSS       120
     HGRHRIVTER TRLAMPETGI GYVPDVGATW LLPRGPGEAG TWLGLTGLDI GAADAIHARL       180
     ADLQIASSRL GEAIDALSAL PRASSSGDVD AVLQALPEPQ GESRLRQNAA MIDRAFCFDN       240
     VEEILATLAE EEGEFAAETR RVLLTRSPTS LKLALRLLRA GRSSASLAEC LGRELGACLR       300
     MLDNPDFFEG IRAAVIDKDR NPKWSPASVE AVEVARVEHF LKPAEPPLSL                  350
//

If you have problems or comments...

PBIL Back to PBIL home page