(data stored in ACNUC7421 zone)

EMBL: CP001622.PE257

CP001622.PE257       Location/Qualifiers
FT   CDS             complement(272428..274485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0258"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: rec:RHECIAT_CH0000646
FT                   ATP-dependent DNA helicase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54569"
FT                   /db_xref="GOA:C6B0F0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0F0"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ACS54569.1"
FT                   /translation="MYLEKLNPQQRMAVEHGTLIDGSHIAGPLLVIAGAGSGKTNTLAH
FT                   RVAHLIVKGADPRRILLMTFSRRAAAEMARRVERICRDVLGANAGVMADALSWSGTFHG
FT                   IGARLLRDYAEQIGLDPGFTIHDREDSADLMNLIRHDLGFSKTESRFPTKGTCLAIYSR
FT                   AVNSETALDLVLRDVFPWCATWEKQLRELFASYVEAKQSQNVLDYDDLLLYWAQMVGEA
FT                   MIAEDIGSRFDHVLVDEYQDTNRLQASILLALKPQGQGLTVVGDDAQSIYSFRAATVRN
FT                   ILDFPAAFSPAANIVTLDRNYRSTQPILAAANAVIDLASERFTKNLWTERQSSERPRLV
FT                   TVRDEAEQARYITDMVLDNREEGLTLKQQAVLFRASHHSGPLEVELTRRNIPFVKFGGL
FT                   KFLDSAHVKDMLAALRFAQNPRDRVAGFRLMQILPGVGPSTAQKTLDLMAEDASPITAL
FT                   GAMPAPPRSGEDWTMFVAMLQELKTGKAGWPAEIGLARQWYAPHLERLHEDAATRQADL
FT                   LQLEQIASGYASRERFLTELTLDPPDATSDQAGVPLLDEDYLILSTIHSAKGQEWTKVF
FT                   MLNVVDGCIPSDLAVGTTAEIEEERRLLYVAMTRARDGLDLVVPQRFFTYGQNSQGDRH
FT                   VYASRSRFIPATLLQFFEACSWPQVKSEAAQAHARQVRIDVGARMRGMWR"
     MYLEKLNPQQ RMAVEHGTLI DGSHIAGPLL VIAGAGSGKT NTLAHRVAHL IVKGADPRRI        60
     LLMTFSRRAA AEMARRVERI CRDVLGANAG VMADALSWSG TFHGIGARLL RDYAEQIGLD       120
     PGFTIHDRED SADLMNLIRH DLGFSKTESR FPTKGTCLAI YSRAVNSETA LDLVLRDVFP       180
     WCATWEKQLR ELFASYVEAK QSQNVLDYDD LLLYWAQMVG EAMIAEDIGS RFDHVLVDEY       240
     QDTNRLQASI LLALKPQGQG LTVVGDDAQS IYSFRAATVR NILDFPAAFS PAANIVTLDR       300
     NYRSTQPILA AANAVIDLAS ERFTKNLWTE RQSSERPRLV TVRDEAEQAR YITDMVLDNR       360
     EEGLTLKQQA VLFRASHHSG PLEVELTRRN IPFVKFGGLK FLDSAHVKDM LAALRFAQNP       420
     RDRVAGFRLM QILPGVGPST AQKTLDLMAE DASPITALGA MPAPPRSGED WTMFVAMLQE       480
     LKTGKAGWPA EIGLARQWYA PHLERLHEDA ATRQADLLQL EQIASGYASR ERFLTELTLD       540
     PPDATSDQAG VPLLDEDYLI LSTIHSAKGQ EWTKVFMLNV VDGCIPSDLA VGTTAEIEEE       600
     RRLLYVAMTR ARDGLDLVVP QRFFTYGQNS QGDRHVYASR SRFIPATLLQ FFEACSWPQV       660
     KSEAAQAHAR QVRIDVGARM RGMWR                                             685
//

If you have problems or comments...

PBIL Back to PBIL home page