(data stored in ACNUC7421 zone)

EMBL: CP001622.PE258

CP001622.PE258       Location/Qualifiers
FT   CDS             complement(274593..274859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0259"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00574 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54570"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0F1"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00574"
FT                   /protein_id="ACS54570.1"
FT                   /translation="MKALLPALFAGAMLAGCSSADTRALEPIPGSITYGGQPRTKLAKS
FT                   PVGSAVYNQFYNGTGQRVEETYILQPDRSLKLVRREIGPDFPD"
     MKALLPALFA GAMLAGCSSA DTRALEPIPG SITYGGQPRT KLAKSPVGSA VYNQFYNGTG        60
     QRVEETYILQ PDRSLKLVRR EIGPDFPD                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page