(data stored in ACNUC7421 zone)

EMBL: CP001622.PE26

CP001622.PE26        Location/Qualifiers
FT   CDS             25147..25437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0026"
FT                   /product="chorismate mutase"
FT                   /note="TIGRFAM: chorismate mutase; PFAM: Chorismate mutase;
FT                   KEGG: oan:Oant_1078 chorismate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54338"
FT                   /db_xref="GOA:C6AYB4"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR010951"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYB4"
FT                   /inference="protein motif:TFAM:TIGR01795"
FT                   /protein_id="ACS54338.1"
FT                   /translation="MTSTFPHELLALRASIDNIDAALMHMLAERFRCTKAIGALKARQG
FT                   LPASDPEREQSQIQRLRSLASTSGLDPDFAEKFLTFTIDEVIRHHRAAAAR"
     MTSTFPHELL ALRASIDNID AALMHMLAER FRCTKAIGAL KARQGLPASD PEREQSQIQR        60
     LRSLASTSGL DPDFAEKFLT FTIDEVIRHH RAAAAR                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page