(data stored in ACNUC7421 zone)

EMBL: CP001622.PE262

CP001622.PE262       Location/Qualifiers
FT   CDS             276526..276888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0263"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000651 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54574"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0F5"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000651"
FT                   /protein_id="ACS54574.1"
FT                   /translation="MPVLARGAEVSAEDALLTRLSIETVPRLQREYLRATLTPQDEGTA
FT                   IDVAAYVLSKTFDRWYVEGIFDGAFSWLHAPIKDEVLVTRELIELWQFSPFISYYLEVT
FT                   EIPDCANNSVLLPSCH"
     MPVLARGAEV SAEDALLTRL SIETVPRLQR EYLRATLTPQ DEGTAIDVAA YVLSKTFDRW        60
     YVEGIFDGAF SWLHAPIKDE VLVTRELIEL WQFSPFISYY LEVTEIPDCA NNSVLLPSCH       120
//

If you have problems or comments...

PBIL Back to PBIL home page