(data stored in ACNUC7421 zone)

EMBL: CP001622.PE264

CP001622.PE264       Location/Qualifiers
FT   CDS             277464..278756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0265"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="KEGG: rec:RHECIAT_CH0000654 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase protein; TIGRFAM:
FT                   UDP-N-acetylglucosamine 1-carboxyvinyltransferase; PFAM:
FT                   EPSP synthase (3-phosphoshikimate
FT                   1-carboxyvinyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54576"
FT                   /db_xref="GOA:C6B0F7"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0F7"
FT                   /inference="protein motif:TFAM:TIGR01072"
FT                   /protein_id="ACS54576.1"
FT                   /translation="MDRIRIVGGNELNGIIPISGAKNAALPLMIASLLTSDTLTLENVP
FT                   HLADVELLMRILGNHGVDVAVNGRRERQEDAYSRTIHFTCRTIVDTTASYELVSKMRAS
FT                   FWVIGPLLAREGHCRVSLPGGCAIGTRPVDLFIEGLTALGATMEIDAGYINAKAPAGGL
FT                   IGARYTFPKVSVGATHVMMMAATLARGTTVIGNAAREPEVVDLANCLNAMGARISGAGT
FT                   ATITIEGVTSLSGARHRVLPDRIETGTYAMAVAMAGGDVVLENTDVALLETAVETLRRA
FT                   GAEISSTNNGMRIKRNGAGIRPVDIVTDPFPGFPTDLQAQFMALMTRSSGVSHVTETIF
FT                   ENRFMHVQELARLGARISLSGQTAKIEGVQRLRGAPVMATDLRASVSLVIAGLAAEGET
FT                   TVSRVYHLDRGFERLEEKLTRCGAIVERISE"
     MDRIRIVGGN ELNGIIPISG AKNAALPLMI ASLLTSDTLT LENVPHLADV ELLMRILGNH        60
     GVDVAVNGRR ERQEDAYSRT IHFTCRTIVD TTASYELVSK MRASFWVIGP LLAREGHCRV       120
     SLPGGCAIGT RPVDLFIEGL TALGATMEID AGYINAKAPA GGLIGARYTF PKVSVGATHV       180
     MMMAATLARG TTVIGNAARE PEVVDLANCL NAMGARISGA GTATITIEGV TSLSGARHRV       240
     LPDRIETGTY AMAVAMAGGD VVLENTDVAL LETAVETLRR AGAEISSTNN GMRIKRNGAG       300
     IRPVDIVTDP FPGFPTDLQA QFMALMTRSS GVSHVTETIF ENRFMHVQEL ARLGARISLS       360
     GQTAKIEGVQ RLRGAPVMAT DLRASVSLVI AGLAAEGETT VSRVYHLDRG FERLEEKLTR       420
     CGAIVERISE                                                              430
//

If you have problems or comments...

PBIL Back to PBIL home page