(data stored in ACNUC7421 zone)

EMBL: CP001622.PE265

CP001622.PE265       Location/Qualifiers
FT   CDS             278865..279296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0266"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000655 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54577"
FT                   /db_xref="InterPro:IPR021335"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0F8"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000655"
FT                   /protein_id="ACS54577.1"
FT                   /translation="MTDLKLVALDNEDLAIMSAHMQDSVFKVGDIDWSPRDAQFALAAN
FT                   RFVWEGAERKRKGFERRRAALVFKRVLAVRSLGIDRGKRDEVLSLLALRFEQKGEGPEG
FT                   TIELSLSGTASIALDVECIEVQLADIGGAWEASSKPRHR"
     MTDLKLVALD NEDLAIMSAH MQDSVFKVGD IDWSPRDAQF ALAANRFVWE GAERKRKGFE        60
     RRRAALVFKR VLAVRSLGID RGKRDEVLSL LALRFEQKGE GPEGTIELSL SGTASIALDV       120
     ECIEVQLADI GGAWEASSKP RHR                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page