(data stored in ACNUC7421 zone)

EMBL: CP001622.PE266

CP001622.PE266       Location/Qualifiers
FT   CDS             279413..280711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0267"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="KEGG: rec:RHECIAT_CH0000656 histidinol dehydrogenase
FT                   protein; TIGRFAM: histidinol dehydrogenase; PFAM:
FT                   histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54578"
FT                   /db_xref="GOA:C6B0F9"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0F9"
FT                   /inference="protein motif:TFAM:TIGR00069"
FT                   /protein_id="ACS54578.1"
FT                   /translation="MAIWLDQASEGFEQHFAAFLTTKREVSEDVNVVVRTIIDDVRARG
FT                   DVALAEYSLKFDSIDYATVPMRVTAEEIDAAVEAVPSEVLGALKLAALRIESHHRRQLP
FT                   KDDIYEDDMGVSLGSRWTAIEAVGLYVPGGTASYPSSVLMNAVPAKVAGVDRIVIAVPA
FT                   TGGAVNPAVLAAAKLVGVTEIYRVGGAQAIAALAYGTETIAPVAKITGPGNAYVAAAKR
FT                   HVFGTVGIDMIAGPSEVLVIADKDNNPDWIAADLLAQAEHDVSSQAILITDDAAFGKAV
FT                   EQAVERQLKTLNRAETAAASWRDFGAVILVADLKQAIPLANRIAAEHLELAVADPDRLL
FT                   DGIRNAGAIFIGAHTPEVIGDYVGGSNHVLPTARSARFSSGLSVLDFVKRTSILRLGPQ
FT                   QLRTLGPAAIALAVSEGLDAHARSVAIRLNLER"
     MAIWLDQASE GFEQHFAAFL TTKREVSEDV NVVVRTIIDD VRARGDVALA EYSLKFDSID        60
     YATVPMRVTA EEIDAAVEAV PSEVLGALKL AALRIESHHR RQLPKDDIYE DDMGVSLGSR       120
     WTAIEAVGLY VPGGTASYPS SVLMNAVPAK VAGVDRIVIA VPATGGAVNP AVLAAAKLVG       180
     VTEIYRVGGA QAIAALAYGT ETIAPVAKIT GPGNAYVAAA KRHVFGTVGI DMIAGPSEVL       240
     VIADKDNNPD WIAADLLAQA EHDVSSQAIL ITDDAAFGKA VEQAVERQLK TLNRAETAAA       300
     SWRDFGAVIL VADLKQAIPL ANRIAAEHLE LAVADPDRLL DGIRNAGAIF IGAHTPEVIG       360
     DYVGGSNHVL PTARSARFSS GLSVLDFVKR TSILRLGPQQ LRTLGPAAIA LAVSEGLDAH       420
     ARSVAIRLNL ER                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page