(data stored in ACNUC7421 zone)

EMBL: CP001622.PE267

CP001622.PE267       Location/Qualifiers
FT   CDS             280716..281189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0268"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ret:RHE_CH00582 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54579"
FT                   /db_xref="InterPro:IPR008321"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0G0"
FT                   /inference="protein motif:PFAM:PF06793"
FT                   /protein_id="ACS54579.1"
FT                   /translation="MAKGEFRLCDVVLDDTIGRSTPDVEHERAVAIFDLIEENRFEPLG
FT                   HAGGPYRLNISLVDSKLVFAITTEEGGGVATHILSLTPFRRIVKDYFMICESYYEAIRS
FT                   STPSRIEAIDMGRRGIHNEGSQTLKDRLAGKIEVDFDTARRLFTLVCVLYWRG"
     MAKGEFRLCD VVLDDTIGRS TPDVEHERAV AIFDLIEENR FEPLGHAGGP YRLNISLVDS        60
     KLVFAITTEE GGGVATHILS LTPFRRIVKD YFMICESYYE AIRSSTPSRI EAIDMGRRGI       120
     HNEGSQTLKD RLAGKIEVDF DTARRLFTLV CVLYWRG                                157
//

If you have problems or comments...

PBIL Back to PBIL home page