(data stored in ACNUC7421 zone)

EMBL: CP001622.PE268

CP001622.PE268       Location/Qualifiers
FT   CDS             281195..281671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0269"
FT                   /product="Protein-tyrosine phosphatase, low molecular
FT                   weight"
FT                   /note="SMART: Protein-tyrosine phosphatase, low molecular
FT                   weight; KEGG: rec:RHECIAT_CH0000658 putative arsenate
FT                   reductase (phosphatase) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54580"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0G1"
FT                   /inference="protein motif:SMART:SM00226"
FT                   /protein_id="ACS54580.1"
FT                   /translation="MELAVDVEEGKRPGAILFMCGMNAIRSPMAEAIARSILPANTYIR
FT                   SAGVRAGERDPFVDVVLEEIGLSLGRRQPQTLEELEDDYFDLIITLSPQAHHAALELTR
FT                   SSAVDVVYWPTMDPTVAIGTREQILESYREVRDHLAGLIESRLLKRNGIAAQSA"
     MELAVDVEEG KRPGAILFMC GMNAIRSPMA EAIARSILPA NTYIRSAGVR AGERDPFVDV        60
     VLEEIGLSLG RRQPQTLEEL EDDYFDLIIT LSPQAHHAAL ELTRSSAVDV VYWPTMDPTV       120
     AIGTREQILE SYREVRDHLA GLIESRLLKR NGIAAQSA                               158
//

If you have problems or comments...

PBIL Back to PBIL home page