(data stored in ACNUC7421 zone)

EMBL: CP001622.PE269

CP001622.PE269       Location/Qualifiers
FT   CDS             281795..282013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0270"
FT                   /product="translation initiation factor IF-1"
FT                   /note="TIGRFAM: translation initiation factor IF-1; PFAM:
FT                   S1 IF1 family protein; KEGG: rec:RHECIAT_CH0000659
FT                   translation initiation factor IF-1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54581"
FT                   /db_xref="GOA:C6B0G2"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0G2"
FT                   /inference="protein motif:TFAM:TIGR00008"
FT                   /protein_id="ACS54581.1"
FT                   /translation="MPKEEVLEFPGIVTELLPNATFRVKLENEHEIIAHTAGRMRKNRI
FT                   RVLAGDKVLVEMTPYDLTKGRITYRFK"
     MPKEEVLEFP GIVTELLPNA TFRVKLENEH EIIAHTAGRM RKNRIRVLAG DKVLVEMTPY        60
     DLTKGRITYR FK                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page