(data stored in ACNUC7421 zone)

EMBL: CP001622.PE27

CP001622.PE27        Location/Qualifiers
FT   CDS             complement(25777..26910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0028"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein;
FT                   transporter-associated region; KEGG: rec:RHECIAT_CH0000413
FT                   putative hemolysin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54339"
FT                   /db_xref="GOA:C6AYB5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYB5"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ACS54339.1"
FT                   /translation="MSDFTTKPAADAKDSEPSSSSDEAGSSSRPSGRSQSFWSRAARIL
FT                   RPQQGSRLREDLADALMTDAAGDDAFSPDERAMLNNILRFREVRVADVMVPRADIEAVD
FT                   QNITIGELMILFEESGRSRMPVYADTLDDPRGMVHIRDLLSYVAKQARNKRRGPAKPAA
FT                   AVPAIEVAPENIHKATRSAKPNFDLARVDLQKTLAEAGIVRKILFVPPSMLASDLLRRM
FT                   QVNRTQMALVIDEYGGTDGLASHEDIVEMVVGDIDDEHDDEEVMFKRVAEDMFIADARV
FT                   ELEEIAQAIGPDFDISEQVDEVDTLGGLIFSALGRIPVRGEVVQALPGFEFHILDADPR
FT                   RIKRLRITRKRHAIRRRAKADGDAAPGDDRPAESTAN"
     MSDFTTKPAA DAKDSEPSSS SDEAGSSSRP SGRSQSFWSR AARILRPQQG SRLREDLADA        60
     LMTDAAGDDA FSPDERAMLN NILRFREVRV ADVMVPRADI EAVDQNITIG ELMILFEESG       120
     RSRMPVYADT LDDPRGMVHI RDLLSYVAKQ ARNKRRGPAK PAAAVPAIEV APENIHKATR       180
     SAKPNFDLAR VDLQKTLAEA GIVRKILFVP PSMLASDLLR RMQVNRTQMA LVIDEYGGTD       240
     GLASHEDIVE MVVGDIDDEH DDEEVMFKRV AEDMFIADAR VELEEIAQAI GPDFDISEQV       300
     DEVDTLGGLI FSALGRIPVR GEVVQALPGF EFHILDADPR RIKRLRITRK RHAIRRRAKA       360
     DGDAAPGDDR PAESTAN                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page