(data stored in ACNUC7421 zone)

EMBL: CP001622.PE270

CP001622.PE270       Location/Qualifiers
FT   CDS             282071..282691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0271"
FT                   /product="maf protein"
FT                   /note="TIGRFAM: maf protein; PFAM: Maf family protein;
FT                   KEGG: ret:RHE_CH00585 Maf-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54582"
FT                   /db_xref="GOA:C6B0G3"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0G3"
FT                   /inference="protein motif:TFAM:TIGR00172"
FT                   /protein_id="ACS54582.1"
FT                   /translation="MALKYKLILASGSPRRVDLLNQAGIEPSRLMPMDIDEAPKKSEHP
FT                   RSLARRLSAEKAEAALAAIKGDITWKGSYILSADTVVAVGRRILGKAEFADEALSSLHL
FT                   LSGRNHMVYTGVCLVTPDRKIRQKIVETKVRFKRLSGFEIENYLASGQWRGKAGAYGIQ
FT                   GLAGTFVQKMVGSYTNVVGLPLYETILLLTGEGFDVHSRWPEG"
     MALKYKLILA SGSPRRVDLL NQAGIEPSRL MPMDIDEAPK KSEHPRSLAR RLSAEKAEAA        60
     LAAIKGDITW KGSYILSADT VVAVGRRILG KAEFADEALS SLHLLSGRNH MVYTGVCLVT       120
     PDRKIRQKIV ETKVRFKRLS GFEIENYLAS GQWRGKAGAY GIQGLAGTFV QKMVGSYTNV       180
     VGLPLYETIL LLTGEGFDVH SRWPEG                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page