(data stored in ACNUC7421 zone)

EMBL: CP001622.PE272

CP001622.PE272       Location/Qualifiers
FT   CDS             283679..284026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0273"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: sme:SMc00089
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54584"
FT                   /db_xref="GOA:C6B0G5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0G5"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACS54584.1"
FT                   /translation="MGEIQKLTIDGKGYVLLSEDDYQDLVDVSDARAAKARIDAGEETW
FT                   PEDVVKALIAGEDPVRVFRKHRGMSIKELAEKSGLSQPYLSEIETGKKEGSLDALRSIA
FT                   SALDVDLDDVA"
     MGEIQKLTID GKGYVLLSED DYQDLVDVSD ARAAKARIDA GEETWPEDVV KALIAGEDPV        60
     RVFRKHRGMS IKELAEKSGL SQPYLSEIET GKKEGSLDAL RSIASALDVD LDDVA            115
//

If you have problems or comments...

PBIL Back to PBIL home page