(data stored in ACNUC7421 zone)

EMBL: CP001622.PE273

CP001622.PE273       Location/Qualifiers
FT   CDS             complement(284185..284463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0274"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   gdj:Gdia_2654 transposase IS3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54585"
FT                   /db_xref="GOA:C6B0G6"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0G6"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ACS54585.1"
FT                   /translation="MGKRKFDDDQITGILKEHQAGVTVADVCHKHGISEPTFYRWQSLQ
FT                   FGNVGLHAKRLRALEEENQKLKKLLAESMLSAATLSEMLAKTLKGRH"
     MGKRKFDDDQ ITGILKEHQA GVTVADVCHK HGISEPTFYR WQSLQFGNVG LHAKRLRALE        60
     EENQKLKKLL AESMLSAATL SEMLAKTLKG RH                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page