(data stored in ACNUC7421 zone)

EMBL: CP001622.PE274

CP001622.PE274       Location/Qualifiers
FT   CDS             complement(284471..285916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0275"
FT                   /product="type I secretion membrane fusion protein, HlyD
FT                   family"
FT                   /note="TIGRFAM: type I secretion membrane fusion protein,
FT                   HlyD family; PFAM: secretion protein HlyD family protein;
FT                   KEGG: rec:RHECIAT_CH0000667 putative protein secretion
FT                   protein, HlyD family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54586"
FT                   /db_xref="GOA:C6B0G7"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0G7"
FT                   /inference="protein motif:TFAM:TIGR01843"
FT                   /protein_id="ACS54586.1"
FT                   /translation="MALVQLDATPAKFSNSSRTSQQLVPRSTATARQQTAYLPVIESKQ
FT                   RGPAPPSPMPGLRGVVWTGNLLILVFIVGLGIWSVLAPLKSAAIASGVVEPESSRKTIQ
FT                   HLEGGIVRRILVKNGDAVMGGQIVIELDDTKSRSERDSIQGQLWDAEGSRARLLAEQTG
FT                   GDHIAYPEDLRAAMDKYPSVSTILIGQQKIFEARRRVMQAEIQIANEKIAQVRQEIVGL
FT                   GAQKAALADRATISSQELDQVTILSAKGLERRSRLLNLQREKADLDGQQGQVEAQISRA
FT                   YQVISGSQADLAKLESDRLSEVAQGMRDTESRIMQLRERLRAIDDQLSRTDIRAPEDGT
FT                   IMNLRIHTSGGVIGAGEPLVDLLPRSDRLVVSAHVRPEDINLVHAGLEAQVHLLPYNQR
FT                   RVPLLKGRVEYVSADRLTDPQSGQPYFAATIRVTDERLAKMKDVELVAGMPAQILIETG
FT                   KSSVALYAVRPLLDSFNRAFRED"
     MALVQLDATP AKFSNSSRTS QQLVPRSTAT ARQQTAYLPV IESKQRGPAP PSPMPGLRGV        60
     VWTGNLLILV FIVGLGIWSV LAPLKSAAIA SGVVEPESSR KTIQHLEGGI VRRILVKNGD       120
     AVMGGQIVIE LDDTKSRSER DSIQGQLWDA EGSRARLLAE QTGGDHIAYP EDLRAAMDKY       180
     PSVSTILIGQ QKIFEARRRV MQAEIQIANE KIAQVRQEIV GLGAQKAALA DRATISSQEL       240
     DQVTILSAKG LERRSRLLNL QREKADLDGQ QGQVEAQISR AYQVISGSQA DLAKLESDRL       300
     SEVAQGMRDT ESRIMQLRER LRAIDDQLSR TDIRAPEDGT IMNLRIHTSG GVIGAGEPLV       360
     DLLPRSDRLV VSAHVRPEDI NLVHAGLEAQ VHLLPYNQRR VPLLKGRVEY VSADRLTDPQ       420
     SGQPYFAATI RVTDERLAKM KDVELVAGMP AQILIETGKS SVALYAVRPL LDSFNRAFRE       480
     D                                                                       481
//

If you have problems or comments...

PBIL Back to PBIL home page