(data stored in ACNUC7421 zone)

EMBL: CP001622.PE275

CP001622.PE275       Location/Qualifiers
FT   CDS             complement(285931..287646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0276"
FT                   /product="type I secretion system ATPase"
FT                   /note="KEGG: rec:RHECIAT_CH0000668 putative protein ABC
FT                   transporter protein; TIGRFAM: type I secretion system
FT                   ATPase; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54587"
FT                   /db_xref="GOA:C6B0G8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0G8"
FT                   /inference="protein motif:TFAM:TIGR01842"
FT                   /protein_id="ACS54587.1"
FT                   /translation="MTTISIKPPRPPTQLVVALRACAGAFGLVFLYSCGYNLFLLAPSI
FT                   YLLQIYDRVLSSRSADTLLMLTMIIAIGVMVGSTLDIVRRAALSRIGSWLDHRLRPMVL
FT                   TASFEYAARADTGAATECYRDLAALRQFLDSPASSLFFDVPWAPVFLFLLFLVHPLLGT
FT                   IGLLSALALLLFAFLTELATREPLAYANLALSRSYIRFATALKNIEVIRAMGMQDGAAL
FT                   IVYRDAEMARRAQDIAMHRTEIILGFSKSIRTLAQILMMGSATWLVLANNGSAGIIFVA
FT                   SLLLGRGLAPIEGAIGAWRSFTFARNAFNRLNRMLISVASEHDARMVPLPEPNGLVLDN
FT                   VSYIKPFADRPILTGITLRLAPGDCIALIGPSGSGKSTLGRVIAGVVQATSGCALLGGV
FT                   DISALRLCGGTRHVGYLPQDIELFGGAIKDVIGRLDGGDPGKAIDAAKLVGLHDAIMRL
FT                   PQGYETDIGEGGNLLLRAQRQQLGLARAAYGNPSLIVLDDPNSSLDYDGERMLFTAIER
FT                   MKSRGMTVVIMTHRMGILPVTNKIAIMRNGTVAAFGDSERIYETYLQPPSRTGT"
     MTTISIKPPR PPTQLVVALR ACAGAFGLVF LYSCGYNLFL LAPSIYLLQI YDRVLSSRSA        60
     DTLLMLTMII AIGVMVGSTL DIVRRAALSR IGSWLDHRLR PMVLTASFEY AARADTGAAT       120
     ECYRDLAALR QFLDSPASSL FFDVPWAPVF LFLLFLVHPL LGTIGLLSAL ALLLFAFLTE       180
     LATREPLAYA NLALSRSYIR FATALKNIEV IRAMGMQDGA ALIVYRDAEM ARRAQDIAMH       240
     RTEIILGFSK SIRTLAQILM MGSATWLVLA NNGSAGIIFV ASLLLGRGLA PIEGAIGAWR       300
     SFTFARNAFN RLNRMLISVA SEHDARMVPL PEPNGLVLDN VSYIKPFADR PILTGITLRL       360
     APGDCIALIG PSGSGKSTLG RVIAGVVQAT SGCALLGGVD ISALRLCGGT RHVGYLPQDI       420
     ELFGGAIKDV IGRLDGGDPG KAIDAAKLVG LHDAIMRLPQ GYETDIGEGG NLLLRAQRQQ       480
     LGLARAAYGN PSLIVLDDPN SSLDYDGERM LFTAIERMKS RGMTVVIMTH RMGILPVTNK       540
     IAIMRNGTVA AFGDSERIYE TYLQPPSRTG T                                      571
//

If you have problems or comments...

PBIL Back to PBIL home page