(data stored in ACNUC7421 zone)

EMBL: CP001622.PE276

CP001622.PE276       Location/Qualifiers
FT   CDS             complement(287737..288312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0277"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000669 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54588"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0G9"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000669"
FT                   /protein_id="ACS54588.1"
FT                   /translation="MPIPQISDTIHLNNPDAGDANAGNGGDGHNDGNINYNPVAYVDPV
FT                   QTVYGADTHLHNGDHVWQKAGWDAGSGGDGGFAQAKNGFLAAVTNSGDGGAGGDSHSNG
FT                   SQGNSSGGDTATVNAATTATQYTQLVADQHATILAGVGGNGGNGNNALGGDISSALVHT
FT                   DPETTTVNNSLDHFINAFGHIDVDHLGS"
     MPIPQISDTI HLNNPDAGDA NAGNGGDGHN DGNINYNPVA YVDPVQTVYG ADTHLHNGDH        60
     VWQKAGWDAG SGGDGGFAQA KNGFLAAVTN SGDGGAGGDS HSNGSQGNSS GGDTATVNAA       120
     TTATQYTQLV ADQHATILAG VGGNGGNGNN ALGGDISSAL VHTDPETTTV NNSLDHFINA       180
     FGHIDVDHLG S                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page