(data stored in ACNUC7421 zone)

EMBL: CP001622.PE277

CP001622.PE277       Location/Qualifiers
FT   CDS             288902..289996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0278"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000670 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54589"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0H0"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000670"
FT                   /protein_id="ACS54589.1"
FT                   /translation="MAETRSLVEDLPKAGTDQHLASNLAAGHLALVPTWLPLDVASGPS
FT                   SNSAGSGGDGISEGVISSNALAVFMPSNAAIAGPHSGADAFQGNDALINQHPTEMAGIG
FT                   GNGGSGNVAIGSGDGANHAGTGGNGLFYGGLVSTEVALFAPVNTAVAAGPGATAHAEQS
FT                   NNALFLQGATQIGGMGGSGGDHNVASHGSSMSPGTALTLTGDFYAGHGGDGYFVGTMVD
FT                   VSIAIFSPINIAIGAAGGSAEAHQTNNVIFDQGAVQIAGIGGNGGGFNLSSDTIFTGNH
FT                   ALGGGGDGVGSSTGSMVDVNFGYFHPINIAVPAGGTADAQQVDHVLYDQHALQLAGIAG
FT                   HGGDGNLTDAHSALVDDILSFMHG"
     MAETRSLVED LPKAGTDQHL ASNLAAGHLA LVPTWLPLDV ASGPSSNSAG SGGDGISEGV        60
     ISSNALAVFM PSNAAIAGPH SGADAFQGND ALINQHPTEM AGIGGNGGSG NVAIGSGDGA       120
     NHAGTGGNGL FYGGLVSTEV ALFAPVNTAV AAGPGATAHA EQSNNALFLQ GATQIGGMGG       180
     SGGDHNVASH GSSMSPGTAL TLTGDFYAGH GGDGYFVGTM VDVSIAIFSP INIAIGAAGG       240
     SAEAHQTNNV IFDQGAVQIA GIGGNGGGFN LSSDTIFTGN HALGGGGDGV GSSTGSMVDV       300
     NFGYFHPINI AVPAGGTADA QQVDHVLYDQ HALQLAGIAG HGGDGNLTDA HSALVDDILS       360
     FMHG                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page