(data stored in ACNUC7421 zone)

EMBL: CP001622.PE28

CP001622.PE28        Location/Qualifiers
FT   CDS             complement(26907..27422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0029"
FT                   /product="protein of unknown function UPF0054"
FT                   /note="PFAM: protein of unknown function UPF0054; KEGG:
FT                   rec:RHECIAT_CH0000414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54340"
FT                   /db_xref="GOA:C6AYB6"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYB6"
FT                   /inference="protein motif:PFAM:PF02130"
FT                   /protein_id="ACS54340.1"
FT                   /translation="MAELDIQISVEDIGWPGEETLLSFCERVLGAAVVYLSDSEKQPFP
FT                   TLPPEVSLVFTDDASIQDINAEWRGKDKATNVLSFPAFPVQPGKMPGPMLGDIIIARET
FT                   LEREAAELEKSFDDHLTHLLVHGFLHLLGYDHMNSAEAEIMEGLETRILAQLGLSDPYE
FT                   GQDLKMEP"
     MAELDIQISV EDIGWPGEET LLSFCERVLG AAVVYLSDSE KQPFPTLPPE VSLVFTDDAS        60
     IQDINAEWRG KDKATNVLSF PAFPVQPGKM PGPMLGDIII ARETLEREAA ELEKSFDDHL       120
     THLLVHGFLH LLGYDHMNSA EAEIMEGLET RILAQLGLSD PYEGQDLKME P                171
//

If you have problems or comments...

PBIL Back to PBIL home page