(data stored in ACNUC7421 zone)

EMBL: CP001622.PE281

CP001622.PE281       Location/Qualifiers
FT   CDS             complement(291980..292705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0282"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54593"
FT                   /db_xref="GOA:C6B0H4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0H4"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS54593.1"
FT                   /translation="MEFRGKTVIVTGAGKGIGREIVRMLVERSAQVVALTRSAADVEAL
FT                   RGEFGCRAIQVDLADADATREAAIAALPADFLINCAGTTELQPFLETTVEAFDRLVAVN
FT                   TRAPMIVAQEYARSLIKEGRKGAIVNVSSVASFVGIPDHAAYCASKGGLDGLTRVMAKE
FT                   LAPHGIRANGVHPTVTLTPMAVKAWSDPEKAAGMMKRIPVGRFAEPADIAEVVLFLLSD
FT                   QAAMVNGISMPVDGGYMIA"
     MEFRGKTVIV TGAGKGIGRE IVRMLVERSA QVVALTRSAA DVEALRGEFG CRAIQVDLAD        60
     ADATREAAIA ALPADFLINC AGTTELQPFL ETTVEAFDRL VAVNTRAPMI VAQEYARSLI       120
     KEGRKGAIVN VSSVASFVGI PDHAAYCASK GGLDGLTRVM AKELAPHGIR ANGVHPTVTL       180
     TPMAVKAWSD PEKAAGMMKR IPVGRFAEPA DIAEVVLFLL SDQAAMVNGI SMPVDGGYMI       240
     A                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page