(data stored in ACNUC7421 zone)

EMBL: CP001622.PE282

CP001622.PE282       Location/Qualifiers
FT   CDS             complement(292717..293778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0283"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG:
FT                   rsq:Rsph17025_3579 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54594"
FT                   /db_xref="GOA:C6B0H5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0H5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS54594.1"
FT                   /translation="MANVQVSDVTKKYGSLQVMHGVSVDIEDGEFVVLVGPSGCGKSTL
FT                   LRMIAGLETVSSGDIRIGGRVVTDAPPKERDIAMVFQSYALYPHKTVAENMGFPLKMAK
FT                   RPKAEIDEKVGRAAEILDLTRYLDRYPKQLSGGQRQRVAMGRAIVRDPKVFLFDEPLSN
FT                   LDAKLRVTMRVEIKELHQRLKTTTVYVTHDQIEAMTMANKIVVMRDGRVEQIGKPLDLY
FT                   DFPVNLFVAGFIGSPSMNFLEGRIATRDGRKIVVTEQGITLPMADTNAEEGRAVTYGIR
FT                   PEHITIGEEGVPVEVSVFEPTGSETLIFGRTGGVPIDALIRERIEVDPGRTMYFHIDPR
FT                   RAHIFDRETGQRL"
     MANVQVSDVT KKYGSLQVMH GVSVDIEDGE FVVLVGPSGC GKSTLLRMIA GLETVSSGDI        60
     RIGGRVVTDA PPKERDIAMV FQSYALYPHK TVAENMGFPL KMAKRPKAEI DEKVGRAAEI       120
     LDLTRYLDRY PKQLSGGQRQ RVAMGRAIVR DPKVFLFDEP LSNLDAKLRV TMRVEIKELH       180
     QRLKTTTVYV THDQIEAMTM ANKIVVMRDG RVEQIGKPLD LYDFPVNLFV AGFIGSPSMN       240
     FLEGRIATRD GRKIVVTEQG ITLPMADTNA EEGRAVTYGI RPEHITIGEE GVPVEVSVFE       300
     PTGSETLIFG RTGGVPIDAL IRERIEVDPG RTMYFHIDPR RAHIFDRETG QRL              353
//

If you have problems or comments...

PBIL Back to PBIL home page