(data stored in ACNUC7421 zone)

EMBL: CP001622.PE284

CP001622.PE284       Location/Qualifiers
FT   CDS             complement(294050..294889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0285"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rsq:Rsph17025_3582
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54596"
FT                   /db_xref="GOA:C6B0H7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0H7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS54596.1"
FT                   /translation="MKKTRFPWLPVVLWTLISLATLFPIYWLFVISVKQPFDLFSTPDV
FT                   ILRSFFWKNYQDVLTNPTLRGYMLNSMIISSGNALLVTTLGFLACYALTRFDLAGKESI
FT                   FFWTITNRMAPPAVFLLPLFLLLTQVYRIGDFSLADSKLGMILVYCSFNLPFAIWTLRP
FT                   TVEGIPKELDEAAYMDGASPWTVLYDIIFPLARPGLAVTLILTWVFAWNEYLLAATLTN
FT                   FHARTLTTGLSEYVTTTGTAWGIMAAISMLTLVPALIVFSVVQRHIVAGLTFGAVKG"
     MKKTRFPWLP VVLWTLISLA TLFPIYWLFV ISVKQPFDLF STPDVILRSF FWKNYQDVLT        60
     NPTLRGYMLN SMIISSGNAL LVTTLGFLAC YALTRFDLAG KESIFFWTIT NRMAPPAVFL       120
     LPLFLLLTQV YRIGDFSLAD SKLGMILVYC SFNLPFAIWT LRPTVEGIPK ELDEAAYMDG       180
     ASPWTVLYDI IFPLARPGLA VTLILTWVFA WNEYLLAATL TNFHARTLTT GLSEYVTTTG       240
     TAWGIMAAIS MLTLVPALIV FSVVQRHIVA GLTFGAVKG                              279
//

If you have problems or comments...

PBIL Back to PBIL home page