(data stored in ACNUC7421 zone)

EMBL: CP001622.PE285

CP001622.PE285       Location/Qualifiers
FT   CDS             complement(294894..295769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0286"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54597"
FT                   /db_xref="GOA:C6B0H8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0H8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS54597.1"
FT                   /translation="MHSQKLGWLLLSPTIVILGLFGIFPFIYVLWVSFHSWNPFAANPG
FT                   MIFNWAENYRRLVFDPQFLASLGITLTFVFFAVVSELVLGYILAQALLKDFPGKAVFRT
FT                   IHTLPLIMAPIIVGSVWKLMTTPSIGIIPYLLRSWFGYDLNIGQSAVAAFTVTVIMDIW
FT                   HWTPLVTLSLIAALVSLPSDPFEQAQIDGAGKSQIFWHITLPLIRPAMLATVFIRLMDA
FT                   LRTVDEVLMLTGGGPGSSTRYIGVHIFKEVFPKTNYGYGSAISVIVLYLTIVVCWLLYV
FT                   GLIAPRVKRG"
     MHSQKLGWLL LSPTIVILGL FGIFPFIYVL WVSFHSWNPF AANPGMIFNW AENYRRLVFD        60
     PQFLASLGIT LTFVFFAVVS ELVLGYILAQ ALLKDFPGKA VFRTIHTLPL IMAPIIVGSV       120
     WKLMTTPSIG IIPYLLRSWF GYDLNIGQSA VAAFTVTVIM DIWHWTPLVT LSLIAALVSL       180
     PSDPFEQAQI DGAGKSQIFW HITLPLIRPA MLATVFIRLM DALRTVDEVL MLTGGGPGSS       240
     TRYIGVHIFK EVFPKTNYGY GSAISVIVLY LTIVVCWLLY VGLIAPRVKR G                291
//

If you have problems or comments...

PBIL Back to PBIL home page