(data stored in ACNUC7421 zone)

EMBL: CP001622.PE286

CP001622.PE286       Location/Qualifiers
FT   CDS             complement(295867..297300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0287"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54598"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0H9"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACS54598.1"
FT                   /translation="MNYALKASALALTLSLAATASPAWADFWSDAGAKFKGVTLHGVTE
FT                   STPPSNYIRNVLAPEFEKKTGIKVDIETTSWDQMYDKAIKDMEAKTGIYDMVYIEQDII
FT                   YSYLARNFLVDITKTLKDQPDLKAPTYDDANFTSFADYFKDASGDLFGVPMEAFLKAYL
FT                   YRKDLFEDPKIKEAFKKETGKDLKPATTHAEYTEIAEFFTKYGKDNGMELWGTTAQAHT
FT                   GHPASWYEFFESIAPTFGVYNWGIDAKNNYAATVEHGGAMNGDKAKAALKYWLHLRDIA
FT                   PPESTQSTWTETATTFAAGRVAQGLIYGENAAWIASDPAQSKVVGQVGFALPPLEPGVL
FT                   DDAKAGKGYIGYYDGGAFGVPVTSKNKEASLLFLEFIGQNEVQPDWAIAAPRITNKATF
FT                   DDPKVKEMDVKLGGFYTMLKDDGKLFAGAPPYPFHAQVREATAPIFYDILTGKIGPDEG
FT                   LDQMAAKAEEELTSLGYRK"
     MNYALKASAL ALTLSLAATA SPAWADFWSD AGAKFKGVTL HGVTESTPPS NYIRNVLAPE        60
     FEKKTGIKVD IETTSWDQMY DKAIKDMEAK TGIYDMVYIE QDIIYSYLAR NFLVDITKTL       120
     KDQPDLKAPT YDDANFTSFA DYFKDASGDL FGVPMEAFLK AYLYRKDLFE DPKIKEAFKK       180
     ETGKDLKPAT THAEYTEIAE FFTKYGKDNG MELWGTTAQA HTGHPASWYE FFESIAPTFG       240
     VYNWGIDAKN NYAATVEHGG AMNGDKAKAA LKYWLHLRDI APPESTQSTW TETATTFAAG       300
     RVAQGLIYGE NAAWIASDPA QSKVVGQVGF ALPPLEPGVL DDAKAGKGYI GYYDGGAFGV       360
     PVTSKNKEAS LLFLEFIGQN EVQPDWAIAA PRITNKATFD DPKVKEMDVK LGGFYTMLKD       420
     DGKLFAGAPP YPFHAQVREA TAPIFYDILT GKIGPDEGLD QMAAKAEEEL TSLGYRK          477
//

If you have problems or comments...

PBIL Back to PBIL home page