(data stored in ACNUC7421 zone)

EMBL: CP001622.PE287

CP001622.PE287       Location/Qualifiers
FT   CDS             297598..298482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0288"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: xylose isomerase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54599"
FT                   /db_xref="GOA:C6B0I0"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0I0"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACS54599.1"
FT                   /translation="MRRLGIHSFVWTGGQTQEGLEMALNKTAEHGYRTIEFAYLRPEKF
FT                   NLDRLAKLAQSLDVEIGVTMGLPLDRDVSSEDTSAVSAGKQTLADAVRAVRDIGGNKLG
FT                   GILYSAHTKYNRQPTKKGWDNSVAAIAATAEVARQANVDLVLEVVNRFETNLLNTAAQG
FT                   LKFVAETGSEHVRLHLDTFHMNIEEANPAAAIRLAGDKVGYFHIGESNRGYLGDGVINF
FT                   DLIFDALLDIDYKRDIVFESFSTTVVDEGLSLACAIWRDTWEDNDPLAAHAKRYIELKY
FT                   DEAKRRRATNARP"
     MRRLGIHSFV WTGGQTQEGL EMALNKTAEH GYRTIEFAYL RPEKFNLDRL AKLAQSLDVE        60
     IGVTMGLPLD RDVSSEDTSA VSAGKQTLAD AVRAVRDIGG NKLGGILYSA HTKYNRQPTK       120
     KGWDNSVAAI AATAEVARQA NVDLVLEVVN RFETNLLNTA AQGLKFVAET GSEHVRLHLD       180
     TFHMNIEEAN PAAAIRLAGD KVGYFHIGES NRGYLGDGVI NFDLIFDALL DIDYKRDIVF       240
     ESFSTTVVDE GLSLACAIWR DTWEDNDPLA AHAKRYIELK YDEAKRRRAT NARP             294
//

If you have problems or comments...

PBIL Back to PBIL home page