(data stored in ACNUC7421 zone)

EMBL: CP001622.PE288

CP001622.PE288       Location/Qualifiers
FT   CDS             298545..299759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0289"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54600"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0I1"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACS54600.1"
FT                   /translation="MNDTVSIGSSPRRIRQNNIVAALQTIYAHRSLSRADLARKLGMNR
FT                   SSSGEIVAELTEGGFVQESDESGKQRLEHSRAGRPGIMLELVPDAAFFVGIEIGVEHIS
FT                   AAVIDLSADVRACRKMAFDTMSSTVEKAVAEGVELIVSAMEKRMIGRCKGLGISAPAHI
FT                   RPDGIVTLAPIIGWREVSLKEIGRSAFPAAVPIAVENDANAFAIGDSYRHGVSGVTLFL
FT                   LMETGVGGGIMIDGKLFRGGHGLAGEIGHTLVPGSGGQKFEQLIGREVLIRQYREAIGR
FT                   KHVDLQEFLGDVHDRVPAAVNIAETWSRHLAYALLQACRLLDPDRIVLGGSVASLYPMV
FT                   AARVAVHMSEGQSIPFPTPEIVVDDDAEFGSAFGAACMLHQRFLSLESEEFGGEDGAPI
FT                   QSATS"
     MNDTVSIGSS PRRIRQNNIV AALQTIYAHR SLSRADLARK LGMNRSSSGE IVAELTEGGF        60
     VQESDESGKQ RLEHSRAGRP GIMLELVPDA AFFVGIEIGV EHISAAVIDL SADVRACRKM       120
     AFDTMSSTVE KAVAEGVELI VSAMEKRMIG RCKGLGISAP AHIRPDGIVT LAPIIGWREV       180
     SLKEIGRSAF PAAVPIAVEN DANAFAIGDS YRHGVSGVTL FLLMETGVGG GIMIDGKLFR       240
     GGHGLAGEIG HTLVPGSGGQ KFEQLIGREV LIRQYREAIG RKHVDLQEFL GDVHDRVPAA       300
     VNIAETWSRH LAYALLQACR LLDPDRIVLG GSVASLYPMV AARVAVHMSE GQSIPFPTPE       360
     IVVDDDAEFG SAFGAACMLH QRFLSLESEE FGGEDGAPIQ SATS                        404
//

If you have problems or comments...

PBIL Back to PBIL home page