(data stored in ACNUC7421 zone)

EMBL: CP001622.PE289

CP001622.PE289       Location/Qualifiers
FT   CDS             299790..300767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0290"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: fructokinase;
FT                   K00847 fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54601"
FT                   /db_xref="GOA:C6B0I2"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0I2"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACS54601.1"
FT                   /translation="MTSVLAPDPLGPTVCVGEILVEIVATTVGDGFLKAQPLVGPFASG
FT                   APAIFISQCGRLGGKAAMVGAVGDDDFGRVNTDRLKRDGVDVSTISIDSDYPTGSAFVR
FT                   YRKDGSRDFVYNIATSAAARFGWSQAVGDLIHRSGHLHVMGSALSVPSARAVIDKAVDI
FT                   VKARGGTLSVDPNIRKELKLNEDTERRFSKLVAAADLLLPSGEELERAAGVEGEAEAIR
FT                   RLFEIGVKEIVLKRGAEGATYFGRQGDRIDASAFVVQEVDPTGAGDCFGGAYLTCRRLG
FT                   MSPQQALTYASAAGARNVTVLGPMEGAGTQQELDAFIASTERRP"
     MTSVLAPDPL GPTVCVGEIL VEIVATTVGD GFLKAQPLVG PFASGAPAIF ISQCGRLGGK        60
     AAMVGAVGDD DFGRVNTDRL KRDGVDVSTI SIDSDYPTGS AFVRYRKDGS RDFVYNIATS       120
     AAARFGWSQA VGDLIHRSGH LHVMGSALSV PSARAVIDKA VDIVKARGGT LSVDPNIRKE       180
     LKLNEDTERR FSKLVAAADL LLPSGEELER AAGVEGEAEA IRRLFEIGVK EIVLKRGAEG       240
     ATYFGRQGDR IDASAFVVQE VDPTGAGDCF GGAYLTCRRL GMSPQQALTY ASAAGARNVT       300
     VLGPMEGAGT QQELDAFIAS TERRP                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page