(data stored in ACNUC7421 zone)

EMBL: CP001622.PE29

CP001622.PE29        Location/Qualifiers
FT   CDS             complement(27422..28471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0030"
FT                   /product="PhoH family protein"
FT                   /note="PFAM: PhoH family protein; KEGG:
FT                   rec:RHECIAT_CH0000415 phosphate starvation inducible
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54341"
FT                   /db_xref="GOA:C6AYB7"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYB7"
FT                   /inference="protein motif:PFAM:PF02562"
FT                   /protein_id="ACS54341.1"
FT                   /translation="MNGQELVSSSPRHPRTPSDTNHFVLTFENNRFASELFGQFDQNLK
FT                   LLEQRLNIDARARGNSVVITGDVVTTNQARRTLDYLYEKLQKGGSVEQSDVEGAIRMAV
FT                   AADDQLSLPTMERKAKLTMAQVSTRKKTIIARTPTQDAYIRALERAELVFGVGPAGTGK
FT                   TYLAVAHAAQLLERGAVEKIILSRPAVEAGERLGFLPGDMKEKVDPYLRPLYDALYDMI
FT                   PADKVDRAITAGVIEIAPLAFMRGRTLANAAIILDEAQNTTSMQMKMFLTRLGENARMI
FT                   VTGDPSQIDLPRGVKSGLVEALQLLNGVEGISIVRFTDTDVVRHPLVGRIVRAYDSTYA
FT                   VAEDVSRQG"
     MNGQELVSSS PRHPRTPSDT NHFVLTFENN RFASELFGQF DQNLKLLEQR LNIDARARGN        60
     SVVITGDVVT TNQARRTLDY LYEKLQKGGS VEQSDVEGAI RMAVAADDQL SLPTMERKAK       120
     LTMAQVSTRK KTIIARTPTQ DAYIRALERA ELVFGVGPAG TGKTYLAVAH AAQLLERGAV       180
     EKIILSRPAV EAGERLGFLP GDMKEKVDPY LRPLYDALYD MIPADKVDRA ITAGVIEIAP       240
     LAFMRGRTLA NAAIILDEAQ NTTSMQMKMF LTRLGENARM IVTGDPSQID LPRGVKSGLV       300
     EALQLLNGVE GISIVRFTDT DVVRHPLVGR IVRAYDSTYA VAEDVSRQG                   349
//

If you have problems or comments...

PBIL Back to PBIL home page