(data stored in ACNUC7421 zone)

EMBL: CP001622.PE290

CP001622.PE290       Location/Qualifiers
FT   CDS             300767..302044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0291"
FT                   /product="D-tagatose-bisphosphate aldolase class II
FT                   accessory protein AgaZ"
FT                   /note="PFAM: D-tagatose-bisphosphate aldolase class II
FT                   accessory protein AgaZ; KEGG: D-tagatose-bisphosphate
FT                   aldolase, class II, non-catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54602"
FT                   /db_xref="GOA:C6B0I3"
FT                   /db_xref="InterPro:IPR012062"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0I3"
FT                   /inference="protein motif:PFAM:PF08013"
FT                   /protein_id="ACS54602.1"
FT                   /translation="MQVHLNELAKMRIEGHPRGVTSVCSAHPIVLRAALRHGRQQASTV
FT                   LIEATCNQVNHLGGYTGMTPSDFASLVRKIAVEEGCPENLIVLGGDHLGPNPWRDRPAE
FT                   EAMAEAEKMVAAYVDAGFRKIHLDASMGCKGEPVALDDETTAHRAARLAAVAEASAKKR
FT                   GGAMPVYVIGTEVPPPGGADHALTTIDPTAAAAALKTIEVHRRIFAEAGLGQAFERAIG
FT                   LVVQPGVEFGNQNVILYDRSKIDALKSVLTEEPQFVFEAHSTDYQGTRPLAALVEDGFP
FT                   ILKVGPELTFVLREALYALDAIASHLLPDYGQRPLYAAMEALMLDQPGNWSRHYHGTNA
FT                   EMRWLRHYSLSDRIRYYWASAEAQEAVGRLCEALRGQIVPLPLFWQHMPAAQEFADAPL
FT                   DPEQVLIWRVTKSLSDYHAACGVGKN"
     MQVHLNELAK MRIEGHPRGV TSVCSAHPIV LRAALRHGRQ QASTVLIEAT CNQVNHLGGY        60
     TGMTPSDFAS LVRKIAVEEG CPENLIVLGG DHLGPNPWRD RPAEEAMAEA EKMVAAYVDA       120
     GFRKIHLDAS MGCKGEPVAL DDETTAHRAA RLAAVAEASA KKRGGAMPVY VIGTEVPPPG       180
     GADHALTTID PTAAAAALKT IEVHRRIFAE AGLGQAFERA IGLVVQPGVE FGNQNVILYD       240
     RSKIDALKSV LTEEPQFVFE AHSTDYQGTR PLAALVEDGF PILKVGPELT FVLREALYAL       300
     DAIASHLLPD YGQRPLYAAM EALMLDQPGN WSRHYHGTNA EMRWLRHYSL SDRIRYYWAS       360
     AEAQEAVGRL CEALRGQIVP LPLFWQHMPA AQEFADAPLD PEQVLIWRVT KSLSDYHAAC       420
     GVGKN                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page