(data stored in ACNUC7421 zone)

EMBL: CP001622.PE291

CP001622.PE291       Location/Qualifiers
FT   CDS             302075..302800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0292"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: ribitol 2-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54603"
FT                   /db_xref="GOA:C6B0I4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0I4"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS54603.1"
FT                   /translation="MTELNGKIAAVTGAASGIGLASTEAMLAAGATVVLVDRDEKALET
FT                   VCARLGERAIPLKINLLDPGECAGLLDGILSKTGKLDILHANAGTYIGGDLMETDLDTI
FT                   DRMLNLNVNVVIKNVRSVIPHMIERGTGDIVVTSSVAGHSAIPWEPVYSSSKWAMTCFV
FT                   QTMRRQLLKSGIRVGSVSPGPVISALLADWPEENLRKAKEAGALIEPKEVADAIIFMLT
FT                   RPRNVTIRDIVVLPSAFDI"
     MTELNGKIAA VTGAASGIGL ASTEAMLAAG ATVVLVDRDE KALETVCARL GERAIPLKIN        60
     LLDPGECAGL LDGILSKTGK LDILHANAGT YIGGDLMETD LDTIDRMLNL NVNVVIKNVR       120
     SVIPHMIERG TGDIVVTSSV AGHSAIPWEP VYSSSKWAMT CFVQTMRRQL LKSGIRVGSV       180
     SPGPVISALL ADWPEENLRK AKEAGALIEP KEVADAIIFM LTRPRNVTIR DIVVLPSAFD       240
     I                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page