(data stored in ACNUC7421 zone)

EMBL: CP001622.PE292

CP001622.PE292       Location/Qualifiers
FT   CDS             302812..303585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0293"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: sme:SMc02339 putative oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54604"
FT                   /db_xref="GOA:C6B0I5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0I5"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS54604.1"
FT                   /translation="MSYQQKFRLDGERAVVTGGGRAIGLCCTEALAEAGAAVVVIERSE
FT                   ADAVQALALRDRGYDVEVRVGDVTDAARMDAIAAELADGGRPATILVNNAGIGQSGIPA
FT                   QDLTDADWLRMMDVNLNGVFWCSRAFGRPMISMKRGAIVNLGSMSGTICNRPQPQTAYN
FT                   VSKAAVHHLTRSLAAEWAHHGIRVNAVAPTYIETPMVVAVEANRERIPLWLADTPMGRM
FT                   GTPEEVASAVLFLASGAASLMTGAIVNVDAGFTCW"
     MSYQQKFRLD GERAVVTGGG RAIGLCCTEA LAEAGAAVVV IERSEADAVQ ALALRDRGYD        60
     VEVRVGDVTD AARMDAIAAE LADGGRPATI LVNNAGIGQS GIPAQDLTDA DWLRMMDVNL       120
     NGVFWCSRAF GRPMISMKRG AIVNLGSMSG TICNRPQPQT AYNVSKAAVH HLTRSLAAEW       180
     AHHGIRVNAV APTYIETPMV VAVEANRERI PLWLADTPMG RMGTPEEVAS AVLFLASGAA       240
     SLMTGAIVNV DAGFTCW                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page