(data stored in ACNUC7421 zone)

EMBL: CP001622.PE293

CP001622.PE293       Location/Qualifiers
FT   CDS             303723..304547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0294"
FT                   /product="deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /note="PFAM: deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase; KEGG:
FT                   aldolase protein; K01623 fructose-bisphosphate aldolase,
FT                   class I"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54605"
FT                   /db_xref="GOA:C6B0I6"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0I6"
FT                   /inference="protein motif:PFAM:PF01791"
FT                   /protein_id="ACS54605.1"
FT                   /translation="MKSARLNRLFGVSGNCFDVAIDHGMFNERTFLAGIENMKTAIEVI
FT                   AQAAPGAIQLPPGTAPMLQAIPGKQRPALVLRTDIANIYGNPLPSQLFSEMIDRAVEQG
FT                   VALDAACVVVNLLMLPDQPEVYRACVRNVNSLKRECEIYGMPLMVEPLVMQDNSKGAYM
FT                   VDGAIDKILPLVRQAAELGADIIKADPCDNVEEYHRVVEIAQGLPVLVRGGGRVSDQEI
FT                   LIRTKQLMEQGARGIVYGRNVIQHQNPAGMTRALMAIVHDKASVEQALLHIG"
     MKSARLNRLF GVSGNCFDVA IDHGMFNERT FLAGIENMKT AIEVIAQAAP GAIQLPPGTA        60
     PMLQAIPGKQ RPALVLRTDI ANIYGNPLPS QLFSEMIDRA VEQGVALDAA CVVVNLLMLP       120
     DQPEVYRACV RNVNSLKREC EIYGMPLMVE PLVMQDNSKG AYMVDGAIDK ILPLVRQAAE       180
     LGADIIKADP CDNVEEYHRV VEIAQGLPVL VRGGGRVSDQ EILIRTKQLM EQGARGIVYG       240
     RNVIQHQNPA GMTRALMAIV HDKASVEQAL LHIG                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page